PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009607518.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 294aa    MW: 34131.4 Da    PI: 7.4152
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009607518.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.61.2e-121461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+ Ed ll ++++++G   W++ + + g+ R++k+c++rw +yl
   XP_009607518.1 14 KGTWTAKEDMLLTNYINEHGEVGWRSLPMKAGLLRCGKSCRLRWVNYL 61
                     799*****************99**********99************97 PP

2Myb_DNA-binding53.74.8e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE++l+v++ ++lG++ W++Ia +++ gRt++++k++w+++l
   XP_009607518.1  67 RGNFTSEEEDLIVRLYNLLGSR-WSLIAGRIP-GRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.325961IPR017930Myb domain
SuperFamilySSF466898.07E-2711108IPR009057Homeodomain-like
SMARTSM007173.9E-101363IPR001005SANT/Myb domain
PfamPF002495.0E-111461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-201568IPR009057Homeodomain-like
CDDcd001671.37E-61661No hitNo description
PROSITE profilePS5129423.00862116IPR017930Myb domain
SMARTSM007171.5E-1466114IPR001005SANT/Myb domain
PfamPF002492.8E-1567112IPR001005SANT/Myb domain
CDDcd001671.34E-969112No hitNo description
Gene3DG3DSA:1.10.10.603.7E-2469117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MGRKPCCSKE GLRKGTWTAK EDMLLTNYIN EHGEVGWRSL PMKAGLLRCG KSCRLRWVNY  60
LKPGIKRGNF TSEEEDLIVR LYNLLGSRWS LIAGRIPGRT DNEIKNYWNT HLLKKLKSEG  120
LEPKIHKSLA KNTRRRKEKA NVSSQINQKG YKEKKKRNKK GKIEENCNNI EEKEQVAKKI  180
EEQWHTQDSV QAMSGFSSTS EVASEKETNC NNVHCPSSGQ SLEENDNEIY EKLQVIDELL  240
LNDNCLLPTE CTEFNSESQM LEVYEEYFQL VSENSFYHFQ DYAHSFVEFS QDDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A1e-22141402123MYB3
3zqc_D1e-22141402123MYB3
3zqc_G1e-22141402123MYB3
3zqc_J1e-22141402123MYB3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133138RRRKEK
2134156RRKEKANVSSQINQKGYKEKKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009607518.10.0PREDICTED: myb-related protein 308-like
SwissprotP813934e-63MYB08_ANTMA; Myb-related protein 308
TrEMBLK4CI761e-108K4CI76_SOLLC; Uncharacterized protein
STRINGSolyc08g005870.1.11e-107(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.11e-63myb domain protein 5